SUGP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125891
Artikelname: SUGP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125891
Hersteller Artikelnummer: orb2125891
Alternativnummer: BYT-ORB2125891-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD
Konjugation: Biotin
Alternative Synonym: SFRS14, SRFS14
SUGP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 120 kDa
NCBI: 001017392
UniProt: Q8IX01
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD