SUGP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125891
Article Name: SUGP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125891
Supplier Catalog Number: orb2125891
Alternative Catalog Number: BYT-ORB2125891-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD
Conjugation: Biotin
Alternative Names: SFRS14, SRFS14
SUGP2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 120 kDa
NCBI: 001017392
UniProt: Q8IX01
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD