ZNF551 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2126485
Artikelname: ZNF551 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2126485
Hersteller Artikelnummer: orb2126485
Alternativnummer: BYT-ORB2126485-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF551
Konjugation: Biotin
ZNF551 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
UniProt: Q7Z340
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIA