ZNF551 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2126485
Article Name: ZNF551 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2126485
Supplier Catalog Number: orb2126485
Alternative Catalog Number: BYT-ORB2126485-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF551
Conjugation: Biotin
ZNF551 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
UniProt: Q7Z340
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIA