SALL4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127463
Artikelname: SALL4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127463
Hersteller Artikelnummer: orb2127463
Alternativnummer: BYT-ORB2127463-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SALL4
Konjugation: Biotin
Alternative Synonym: DRRS, HSAL4, ZNF797
SALL4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 115kDa
NCBI: 065169
UniProt: Q9UJQ4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVAS