SALL4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127463
Article Name: SALL4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127463
Supplier Catalog Number: orb2127463
Alternative Catalog Number: BYT-ORB2127463-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SALL4
Conjugation: Biotin
Alternative Names: DRRS, HSAL4, ZNF797
SALL4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 115kDa
NCBI: 065169
UniProt: Q9UJQ4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVAS