KCMF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127499
Artikelname: KCMF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127499
Hersteller Artikelnummer: orb2127499
Alternativnummer: BYT-ORB2127499-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCMF1
Konjugation: Biotin
Alternative Synonym: FIGC, PCMF, ZZZ1, DEBT91
KCMF1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 064507
UniProt: Q9P0J7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: STLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNE