KCMF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127499
Article Name: KCMF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127499
Supplier Catalog Number: orb2127499
Alternative Catalog Number: BYT-ORB2127499-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCMF1
Conjugation: Biotin
Alternative Names: FIGC, PCMF, ZZZ1, DEBT91
KCMF1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 064507
UniProt: Q9P0J7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: STLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNE