ZNF395 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127559
Artikelname: ZNF395 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127559
Hersteller Artikelnummer: orb2127559
Alternativnummer: BYT-ORB2127559-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF395
Konjugation: Biotin
Alternative Synonym: PBF, PRF1, HDBP2, PRF-1, HDBP-2, HDRF-2, Si-1-8-14
ZNF395 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 061130
UniProt: Q9H8N7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFL