ZNF395 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127559
Article Name: ZNF395 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127559
Supplier Catalog Number: orb2127559
Alternative Catalog Number: BYT-ORB2127559-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF395
Conjugation: Biotin
Alternative Names: PBF, PRF1, HDBP2, PRF-1, HDBP-2, HDRF-2, Si-1-8-14
ZNF395 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 061130
UniProt: Q9H8N7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFL