CHRAC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127694
Artikelname: CHRAC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127694
Hersteller Artikelnummer: orb2127694
Alternativnummer: BYT-ORB2127694-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHRAC1
Konjugation: Biotin
Alternative Synonym: YCL1, CHARC1, CHARC15, CHRAC-1, CHRAC15, CHRAC-15
CHRAC1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 059140
UniProt: Q9NRG0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS