CHRAC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127694
Article Name: CHRAC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127694
Supplier Catalog Number: orb2127694
Alternative Catalog Number: BYT-ORB2127694-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHRAC1
Conjugation: Biotin
Alternative Names: YCL1, CHARC1, CHARC15, CHRAC-1, CHRAC15, CHRAC-15
CHRAC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 059140
UniProt: Q9NRG0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS