RBM35B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130337
| Artikelname: |
RBM35B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130337 |
| Hersteller Artikelnummer: |
orb2130337 |
| Alternativnummer: |
BYT-ORB2130337-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RBM35B |
| Konjugation: |
FITC |
| Alternative Synonym: |
Rbm35, Rbm35b, 9530027K23Rik |
| RBM35B Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
79kDa |
| NCBI: |
789808 |
| UniProt: |
Q8K0G8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: target=_blank>EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF |
