RBM35B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2130337
| Article Name: |
RBM35B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130337 |
| Supplier Catalog Number: |
orb2130337 |
| Alternative Catalog Number: |
BYT-ORB2130337-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RBM35B |
| Conjugation: |
FITC |
| Alternative Names: |
Rbm35, Rbm35b, 9530027K23Rik |
| RBM35B Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
79kDa |
| NCBI: |
789808 |
| UniProt: |
Q8K0G8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: target=_blank>EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF |
