Zfp192 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130434
| Artikelname: |
Zfp192 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130434 |
| Hersteller Artikelnummer: |
orb2130434 |
| Alternativnummer: |
BYT-ORB2130434-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
LD5-, LD5-1, Zfp19, Zfp192, 2510038J07Rik, D430019P06Rik |
| Zfp192 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
67kDa |
| NCBI: |
631880 |
| UniProt: |
Q8BSL0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ |
