Zfp192 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2130434
| Article Name: |
Zfp192 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130434 |
| Supplier Catalog Number: |
orb2130434 |
| Alternative Catalog Number: |
BYT-ORB2130434-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Biotin |
| Alternative Names: |
LD5-, LD5-1, Zfp19, Zfp192, 2510038J07Rik, D430019P06Rik |
| Zfp192 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
67kDa |
| NCBI: |
631880 |
| UniProt: |
Q8BSL0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ |
