Hes7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130515
Artikelname: Hes7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130515
Hersteller Artikelnummer: orb2130515
Alternativnummer: BYT-ORB2130515-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Hes7
Konjugation: Biotin
Alternative Synonym: bHLHb3, bHLHb37
Hes7 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 149030
UniProt: Q8BKT2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARS