Hes7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130515
Article Name: Hes7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130515
Supplier Catalog Number: orb2130515
Alternative Catalog Number: BYT-ORB2130515-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Hes7
Conjugation: Biotin
Alternative Names: bHLHb3, bHLHb37
Hes7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 149030
UniProt: Q8BKT2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARS