Nkx3-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130875
| Artikelname: |
Nkx3-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130875 |
| Hersteller Artikelnummer: |
orb2130875 |
| Alternativnummer: |
BYT-ORB2130875-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Nkx3-1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Ba, Bax, NKX, bag, NKX3., NKX3A, NKX3.1, Nkx-3., Nkx-3.1, bagpipe |
| Nkx3-1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
27kDa |
| NCBI: |
035051 |
| UniProt: |
P97436 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: TPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIE |
