Nkx3-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2130875
| Article Name: |
Nkx3-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130875 |
| Supplier Catalog Number: |
orb2130875 |
| Alternative Catalog Number: |
BYT-ORB2130875-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Nkx3-1 |
| Conjugation: |
Biotin |
| Alternative Names: |
Ba, Bax, NKX, bag, NKX3., NKX3A, NKX3.1, Nkx-3., Nkx-3.1, bagpipe |
| Nkx3-1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
27kDa |
| NCBI: |
035051 |
| UniProt: |
P97436 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: TPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIE |
