Itsn1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130923
| Artikelname: |
Itsn1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130923 |
| Hersteller Artikelnummer: |
orb2130923 |
| Alternativnummer: |
BYT-ORB2130923-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Itsn1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Ese, EHSH, Ese1, Itsn, Sh3p, Ehsh1, Sh3p17, AA517634, AA545208, AI316805, AI839402, AI848451 |
| Itsn1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
70kDa |
| NCBI: |
001103746 |
| UniProt: |
Q6NZJ5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK |
