Itsn1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2130923
| Article Name: |
Itsn1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130923 |
| Supplier Catalog Number: |
orb2130923 |
| Alternative Catalog Number: |
BYT-ORB2130923-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Itsn1 |
| Conjugation: |
Biotin |
| Alternative Names: |
Ese, EHSH, Ese1, Itsn, Sh3p, Ehsh1, Sh3p17, AA517634, AA545208, AI316805, AI839402, AI848451 |
| Itsn1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
70kDa |
| NCBI: |
001103746 |
| UniProt: |
Q6NZJ5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK |