ZFY1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131031
Artikelname: ZFY1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131031
Hersteller Artikelnummer: orb2131031
Alternativnummer: BYT-ORB2131031-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse ZFY1
Konjugation: Biotin
Alternative Synonym: Zfy2, Zfy-1
ZFY1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 033596
UniProt: P10925
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EQQMDVSEIKAAFLPIAWTAAYDNNSDEIEDQNVTASALLNQDESGGLDR