ZFY1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131031
Article Name: ZFY1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131031
Supplier Catalog Number: orb2131031
Alternative Catalog Number: BYT-ORB2131031-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse ZFY1
Conjugation: Biotin
Alternative Names: Zfy2, Zfy-1
ZFY1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 033596
UniProt: P10925
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EQQMDVSEIKAAFLPIAWTAAYDNNSDEIEDQNVTASALLNQDESGGLDR