Thrb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131049
Artikelname: Thrb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131049
Hersteller Artikelnummer: orb2131049
Alternativnummer: BYT-ORB2131049-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb
Konjugation: Biotin
Alternative Synonym: Nr, Nr1a2, T3R[b, T3Rbe, Thrb1, Thrb2, T3R[b], T3Rbeta, c-erbAb, c-erbAbeta
Thrb Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54
NCBI: 033406
UniProt: P37242
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY