Thrb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2131049
| Artikelname: |
Thrb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2131049 |
| Hersteller Artikelnummer: |
orb2131049 |
| Alternativnummer: |
BYT-ORB2131049-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ChIP, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Nr, Nr1a2, T3R[b, T3Rbe, Thrb1, Thrb2, T3R[b], T3Rbeta, c-erbAb, c-erbAbeta |
| Thrb Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
54 |
| NCBI: |
033406 |
| UniProt: |
P37242 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY |