Thrb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2131049
| Article Name: |
Thrb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2131049 |
| Supplier Catalog Number: |
orb2131049 |
| Alternative Catalog Number: |
BYT-ORB2131049-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb |
| Conjugation: |
Biotin |
| Alternative Names: |
Nr, Nr1a2, T3R[b, T3Rbe, Thrb1, Thrb2, T3R[b], T3Rbeta, c-erbAb, c-erbAbeta |
| Thrb Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
54 |
| NCBI: |
033406 |
| UniProt: |
P37242 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY |
