Stat1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2131076
| Artikelname: |
Stat1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2131076 |
| Hersteller Artikelnummer: |
orb2131076 |
| Alternativnummer: |
BYT-ORB2131076-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Rat Stat1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
DD6G4-4 |
| Stat1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
82kDa |
| NCBI: |
116001 |
| UniProt: |
Q9QXK0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DQVMCIEHEIKTLEDLQDEYDFKCKTSQNRESEANGVAKSDQKQEQLLLH |
