Stat1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131076
Article Name: Stat1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131076
Supplier Catalog Number: orb2131076
Alternative Catalog Number: BYT-ORB2131076-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Stat1
Conjugation: Biotin
Alternative Names: DD6G4-4
Stat1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 116001
UniProt: Q9QXK0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DQVMCIEHEIKTLEDLQDEYDFKCKTSQNRESEANGVAKSDQKQEQLLLH