Pgr Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2131115
| Artikelname: |
Pgr Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2131115 |
| Hersteller Artikelnummer: |
orb2131115 |
| Alternativnummer: |
BYT-ORB2131115-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr |
| Konjugation: |
Biotin |
| Alternative Synonym: |
P, PR, NR3, PR-A, PR-B, NR3C3, BB114106, 9930019P03Rik |
| Pgr Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
99 |
| NCBI: |
032855 |
| UniProt: |
A6H6A5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: SGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGS |
