Pgr Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2131115
| Article Name: |
Pgr Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2131115 |
| Supplier Catalog Number: |
orb2131115 |
| Alternative Catalog Number: |
BYT-ORB2131115-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr |
| Conjugation: |
Biotin |
| Alternative Names: |
P, PR, NR3, PR-A, PR-B, NR3C3, BB114106, 9930019P03Rik |
| Pgr Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
99 |
| NCBI: |
032855 |
| UniProt: |
A6H6A5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGS |
