Nab2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131142
Artikelname: Nab2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131142
Hersteller Artikelnummer: orb2131142
Alternativnummer: BYT-ORB2131142-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Nab2
Konjugation: Biotin
Alternative Synonym: AI451907
Nab2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57
NCBI: 032694
UniProt: Q61127
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: APPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLW