Nab2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131142
Article Name: Nab2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131142
Supplier Catalog Number: orb2131142
Alternative Catalog Number: BYT-ORB2131142-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Nab2
Conjugation: Biotin
Alternative Names: AI451907
Nab2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57
NCBI: 032694
UniProt: Q61127
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: APPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLW