Pias2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131148
Artikelname: Pias2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131148
Hersteller Artikelnummer: orb2131148
Alternativnummer: BYT-ORB2131148-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Pias2
Konjugation: Biotin
Alternative Synonym: Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6
Pias2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 96678
UniProt: Q8C5D8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE