Pias2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2131148
| Article Name: |
Pias2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2131148 |
| Supplier Catalog Number: |
orb2131148 |
| Alternative Catalog Number: |
BYT-ORB2131148-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Pias2 |
| Conjugation: |
Biotin |
| Alternative Names: |
Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6 |
| Pias2 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
54kDa |
| NCBI: |
96678 |
| UniProt: |
Q8C5D8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE |
