DDX59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131760
Artikelname: DDX59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131760
Hersteller Artikelnummer: orb2131760
Alternativnummer: BYT-ORB2131760-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX59
Konjugation: Biotin
Alternative Synonym: OFD5, ZNHIT5
DDX59 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 112596
UniProt: Q5T1V6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR