DDX59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131760
Article Name: DDX59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131760
Supplier Catalog Number: orb2131760
Alternative Catalog Number: BYT-ORB2131760-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX59
Conjugation: Biotin
Alternative Names: OFD5, ZNHIT5
DDX59 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 112596
UniProt: Q5T1V6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR