ZNF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132609
Artikelname: ZNF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132609
Hersteller Artikelnummer: orb2132609
Alternativnummer: BYT-ORB2132609-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF2
Konjugation: Biotin
Alternative Synonym: A1-5, ZNF661, Zfp661
ZNF2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 066574
UniProt: Q9BSG1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQ