ZNF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132609
Article Name: ZNF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132609
Supplier Catalog Number: orb2132609
Alternative Catalog Number: BYT-ORB2132609-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF2
Conjugation: Biotin
Alternative Names: A1-5, ZNF661, Zfp661
ZNF2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 066574
UniProt: Q9BSG1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQ