ZNF248 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132612
Artikelname: ZNF248 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132612
Hersteller Artikelnummer: orb2132612
Alternativnummer: BYT-ORB2132612-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF248
Konjugation: Biotin
Alternative Synonym: bA162G10.3
ZNF248 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 066383
UniProt: Q8NDW4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NKTVSVENGDRGSKTFNLGTDPVSLRNYPYKICDSCEMNLKNISGLIISK