ZNF248 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132612
Article Name: ZNF248 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132612
Supplier Catalog Number: orb2132612
Alternative Catalog Number: BYT-ORB2132612-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF248
Conjugation: Biotin
Alternative Names: bA162G10.3
ZNF248 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 066383
UniProt: Q8NDW4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NKTVSVENGDRGSKTFNLGTDPVSLRNYPYKICDSCEMNLKNISGLIISK