ZNF581 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132732
Artikelname: ZNF581 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132732
Hersteller Artikelnummer: orb2132732
Alternativnummer: BYT-ORB2132732-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF581
Konjugation: Biotin
Alternative Synonym: HSPC189
ZNF581 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 057619
UniProt: Q9P0T4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICG