ZNF581 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132732
Article Name: ZNF581 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132732
Supplier Catalog Number: orb2132732
Alternative Catalog Number: BYT-ORB2132732-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF581
Conjugation: Biotin
Alternative Names: HSPC189
ZNF581 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 057619
UniProt: Q9P0T4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICG