ZNF507 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132786
Artikelname: ZNF507 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132786
Hersteller Artikelnummer: orb2132786
Alternativnummer: BYT-ORB2132786-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF507
Konjugation: Biotin
Alternative Synonym: Zfp507
ZNF507 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 106kDa
NCBI: 055725
UniProt: Q8TCN5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SDGQVKTGISMSLLTVIEKLRERTDQNASDDDILKELQDNAQCQPNSDTS