ZNF507 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132786
Article Name: ZNF507 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132786
Supplier Catalog Number: orb2132786
Alternative Catalog Number: BYT-ORB2132786-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF507
Conjugation: Biotin
Alternative Names: Zfp507
ZNF507 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 106kDa
NCBI: 055725
UniProt: Q8TCN5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SDGQVKTGISMSLLTVIEKLRERTDQNASDDDILKELQDNAQCQPNSDTS