ZNF214 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132846
Artikelname: ZNF214 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132846
Hersteller Artikelnummer: orb2132846
Alternativnummer: BYT-ORB2132846-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF214
Konjugation: Biotin
Alternative Synonym: BAZ1, BAZ-1
ZNF214 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 037381
UniProt: Q9UL59
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TNVMSVENWNESYKSQEEKFRYLEYENFSYWQGWWNAGAQMYENQNYGET