ZNF214 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132846
Article Name: ZNF214 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132846
Supplier Catalog Number: orb2132846
Alternative Catalog Number: BYT-ORB2132846-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF214
Conjugation: Biotin
Alternative Names: BAZ1, BAZ-1
ZNF214 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 037381
UniProt: Q9UL59
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TNVMSVENWNESYKSQEEKFRYLEYENFSYWQGWWNAGAQMYENQNYGET