ZRANB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132999
Artikelname: ZRANB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132999
Hersteller Artikelnummer: orb2132999
Alternativnummer: BYT-ORB2132999-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZRANB2
Konjugation: Biotin
Alternative Synonym: ZIS, ZIS1, ZIS2, ZNF265
ZRANB2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 005446
UniProt: O95218
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED