ZRANB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2132999
Article Name: ZRANB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2132999
Supplier Catalog Number: orb2132999
Alternative Catalog Number: BYT-ORB2132999-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZRANB2
Conjugation: Biotin
Alternative Names: ZIS, ZIS1, ZIS2, ZNF265
ZRANB2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 005446
UniProt: O95218
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED