Trim35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2135024
| Artikelname: |
Trim35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2135024 |
| Hersteller Artikelnummer: |
orb2135024 |
| Alternativnummer: |
BYT-ORB2135024-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of MOUSE Trim35 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
M, Hl, NC8, HLS5, Mair, AW046487, mKIAA1098, 0710005M05Rik, A430106H13Rik |
| Trim35 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
55kDa |
| NCBI: |
084255 |
| UniProt: |
Q8C006 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV |
