Trim35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2135024
| Article Name: |
Trim35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2135024 |
| Supplier Catalog Number: |
orb2135024 |
| Alternative Catalog Number: |
BYT-ORB2135024-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of MOUSE Trim35 |
| Conjugation: |
Biotin |
| Alternative Names: |
M, Hl, NC8, HLS5, Mair, AW046487, mKIAA1098, 0710005M05Rik, A430106H13Rik |
| Trim35 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
55kDa |
| NCBI: |
084255 |
| UniProt: |
Q8C006 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV |
